Startpaginaarrow-rightChina Fabriek Indexarrow-rightdrankenverwerkingslijn fabriekarrow-rightleverancierslijst
Filter
Categorie
Meer
Beheer Certificering
Meer
R&D-capaciteit
Jaaromzet
Meer
Aantal werknemers
Meer
Provincie & Regio
Meer
ongeveer drankenverwerkingslijn
  • Technologische innovatie
  • Betrouwbare toeleveringsketens
  • Aanzienlijke productiemogelijkheden

drankenverwerkingslijn4,000+ fabrieken geverifieerd

Zhangjiagang King Machine Co., Ltd.

18 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
9, 000 l/h Beverage Process Pipeline UHT-sterilisator-installatielijn voor buisjes

9, 000 l/h Beverage Process Pipeline UHT-sterilisator-installatielijn voor buisjes

US$ 10.000,00
1 Set(MOQ)
Koolzuurhoudende dranken kunnen de productielijn voor productieprocessen vullen

Koolzuurhoudende dranken kunnen de productielijn voor productieprocessen vullen

US$ 10.000,00-60.000,00
1 Set(MOQ)
Productieproces voor frisdrank in de vullijn van koolzuurhoudende CAN

Productieproces voor frisdrank in de vullijn van koolzuurhoudende CAN

US$ 10.000,00-60.000,00
1 Set(MOQ)
Carbonaatdrank kan de productielijn voor frisdranken vullen

Carbonaatdrank kan de productielijn voor frisdranken vullen

US$ 10.000,00-60.000,00
1 Set(MOQ)
1/4

Anhui Peiyu Packaging Technology Co.,Ltd.

14 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Water Nabehandeling Verpakkingsapparatuur Drank Achterkant Productielijn

Water Nabehandeling Verpakkingsapparatuur Drank Achterkant Productielijn

US$ 50.000,00-500.000,00
1 Set(MOQ)
Volledig automatische en efficiënte steriele productieproces aseptische verwerkingslijn

Volledig automatische en efficiënte steriele productieproces aseptische verwerkingslijn

US$ 700.000,00-3.000.000,00
1 Set(MOQ)
32, 000 Bph Pet Flessenwater Einde van Lijn Post Proces Verpakkingsapparatuur

32, 000 Bph Pet Flessenwater Einde van Lijn Post Proces Verpakkingsapparatuur

US$ 500.000,00-5.000.000,00
1 Set(MOQ)
Volledig automatische en efficiënte productie van steriele injectables steriele voedselverpakkingslijn

Volledig automatische en efficiënte productie van steriele injectables steriele voedselverpakkingslijn

US$ 700.000,00-3.000.000,00
1 Set(MOQ)
1/4

Zhangjiagang Alps Machine Co., Ltd.

Verstuur aanvraag
Topkwaliteit koolzuurhoudende drankproductielijn vulproces

Topkwaliteit koolzuurhoudende drankproductielijn vulproces

US$ 2.500,00-65.000,00
1 Stuk(MOQ)
Volledige Plastic Huisdierfles Glazen Fles Mineraalwater Drinkwater Koolzuurhoudende Frisdrank Soda Sap Drankverpakkings- en Verpakkingsmachine

Volledige Plastic Huisdierfles Glazen Fles Mineraalwater Drinkwater Koolzuurhoudende Frisdrank Soda Sap Drankverpakkings- en Verpakkingsmachine

US$ 5.500,00-75.000,00
1 Stuk(MOQ)
2000-3000 Bph Kleine Verse Sap Verwerkings- en Vullijn

2000-3000 Bph Kleine Verse Sap Verwerkings- en Vullijn

US$ 2.500,00-55.000,00
1 Stuk(MOQ)
Vloeibare Verpakking Was- Vul- en Sluitmachine voor Sapfles

Vloeibare Verpakking Was- Vul- en Sluitmachine voor Sapfles

US$ 10.000,00
1 Stuk(MOQ)
1/4

Zhangjiagang Proman Machine Co., Ltd.

5.0
Verstuur aanvraag
Volledige Pet Plastic Fles 0.33L 0.5L 1L Mineraal Drinkwater Drank Sap Frisdrank Proces Vullen Bottelen Productielijn

Volledige Pet Plastic Fles 0.33L 0.5L 1L Mineraal Drinkwater Drank Sap Frisdrank Proces Vullen Bottelen Productielijn

US$ 11.500,00-46.800,00
1 Stuk(MOQ)
Volautomatisch proces voor het vullen en verpakken van bierdranken in aluminium blikken, apparatuur voor de productielijn

Volautomatisch proces voor het vullen en verpakken van bierdranken in aluminium blikken, apparatuur voor de productielijn

US$ 16.800,00
1 Stuk(MOQ)
Automatische NFC Fruit Sap Gemengde Sap Geparfumeerd Water Pet Fles Botteling Plant Heet Vullen Verpakkingsproces Productielijn

Automatische NFC Fruit Sap Gemengde Sap Geparfumeerd Water Pet Fles Botteling Plant Heet Vullen Verpakkingsproces Productielijn

US$ 9.600,00
1 Stuk(MOQ)
Volledige Pure Mineraal Flessenwater Productielijn voor Vulproces

Volledige Pure Mineraal Flessenwater Productielijn voor Vulproces

US$ 15.000,00-48.000,00
1 Stuk(MOQ)
1/4

Chun Nuo Intel-Mfg Tech.Co., Ltd.

12 jaar·5.0
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
500-10000L Turbo-vacuümmixer voor de productielijn voor zuivelproducten, dranken en vloeibare voedingsmiddelen

500-10000L Turbo-vacuümmixer voor de productielijn voor zuivelproducten, dranken en vloeibare voedingsmiddelen

US$ 30.000,00-60.000,00
1 Stuk(MOQ)
Hoogwaardige slagroom vloeibare proceslijn

Hoogwaardige slagroom vloeibare proceslijn

US$ 30.000,00-60.000,00
1 Stuk(MOQ)
Melkroomseparator Machine Industriële Melkproductieproces Melk Compleet Verwerkingslijn

Melkroomseparator Machine Industriële Melkproductieproces Melk Compleet Verwerkingslijn

US$ 25.000,00
1 sets(MOQ)
Multifunctionele melk pasteurisatie skid en koeling 700 L kaas machine prijs kleine yoghurt verwerkingslijn

Multifunctionele melk pasteurisatie skid en koeling 700 L kaas machine prijs kleine yoghurt verwerkingslijn

US$ 20.000,00-50.000,00
1 Set(MOQ)
1/4

Oushangyuan Process & Equipment Intelligent Co.

7 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
ISO Hoge Terugkeer Hoge Kwaliteit Complete Erythritol Productielijn

ISO Hoge Terugkeer Hoge Kwaliteit Complete Erythritol Productielijn

US$ 8.200.000,00-12.100.000,00
1 Set(MOQ)
Automatische Hoge Kwaliteit Heet Verkoop Efficiënte Industriële Aangepaste Fructosestroop Productielijn

Automatische Hoge Kwaliteit Heet Verkoop Efficiënte Industriële Aangepaste Fructosestroop Productielijn

US$ 7.500.000,00-16.200.000,00
1 Set(MOQ)
Hoge efficiëntie lage consumptie fabriek rechtstreeks aanbod hoge productiviteit fructose productielijn

Hoge efficiëntie lage consumptie fabriek rechtstreeks aanbod hoge productiviteit fructose productielijn

US$ 7.500.000,00-16.200.000,00
1 Set(MOQ)
Economische Standaard Automatische Hoge Efficiëntie Hoge Productiviteit Citroenzuur Productielijn

Economische Standaard Automatische Hoge Efficiëntie Hoge Productiviteit Citroenzuur Productielijn

US$ 5.600.000,00-15.800.000,00
1 Set(MOQ)
1/4

Anhui Jinke Foodstuff Machinery Co., Ltd.

Verstuur aanvraag
Procesautomatisering Tongguan Vleespastei Constructiemachines Productielijn

Procesautomatisering Tongguan Vleespastei Constructiemachines Productielijn

US$ 3.611,00-111.111,00
1 Set(MOQ)
Procesautomatisering Parotta productieproceslijn

Procesautomatisering Parotta productieproceslijn

US$ 3.611,00-111.111,00
1 Set(MOQ)
Procesautomatisering tortilla voedselmachine productielijn constructiemachines

Procesautomatisering tortilla voedselmachine productielijn constructiemachines

US$ 3.611,00-111.111,00
1 Set(MOQ)
Automatische RVS Voedselmachine Roti Proces Automatisering Productielijn

Automatische RVS Voedselmachine Roti Proces Automatisering Productielijn

US$ 3.611,00-111.111,00
1 Set(MOQ)
1/4

Changzhou Jinqiao Spray Drying and Engineering Co., Ltd.

17 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Productieprocesapparatuur/-lijn voor niet-zuivelroomer

Productieprocesapparatuur/-lijn voor niet-zuivelroomer

US$ 1.000.000,00-10.000.000,00
1 Set(MOQ)
Productieproceslijn / Melk- en yoghurtproductielijn

Productieproceslijn / Melk- en yoghurtproductielijn

US$ 300.000,00-5.000.000,00
1 Set(MOQ)
Thee bladeren extractie en poederoplossing thee drank proceslijn

Thee bladeren extractie en poederoplossing thee drank proceslijn

US$ 200.000,00-4.000.000,00
1 Set(MOQ)
Hoge Kwaliteit Koffiemelk-- Vloeibare Room Proceslijn

Hoge Kwaliteit Koffiemelk-- Vloeibare Room Proceslijn

US$ 500.000,00-8.000.000,00
1 Set(MOQ)
1/4

Beijing Meckey Engineering Co.

4.0
Verstuur aanvraag
Meckey Innovatief Extractieproces voor Citroenzuurproductielijn uit Maïs (citricacid)

Meckey Innovatief Extractieproces voor Citroenzuurproductielijn uit Maïs (citricacid)

US$ 8.000.000,00-15.000.000,00
1 Set(MOQ)
Meckey Innovatief Fermentatieproces voor Citroenzuurproductielijn Van Tarwe (citricacid)

Meckey Innovatief Fermentatieproces voor Citroenzuurproductielijn Van Tarwe (citricacid)

US$ 8.000.000,00-15.000.000,00
1 Set(MOQ)
Meckey Innovatief Extractieproces voor Citroenzuurproductielijn uit Rijst (citricacid)

Meckey Innovatief Extractieproces voor Citroenzuurproductielijn uit Rijst (citricacid)

US$ 8.000.000,00-15.000.000,00
1 Set(MOQ)
Meckey Innovatief Extractieproces voor Citroenzuurproductielijn uit Tarwe (citricacid)

Meckey Innovatief Extractieproces voor Citroenzuurproductielijn uit Tarwe (citricacid)

US$ 8.000.000,00-15.000.000,00
1 Set(MOQ)
1/4

Qingzhou Chengde Packing Machinery Co., Ltd.

Verstuur aanvraag
Koolzuurhoudende Drank Vullijn van A tot Z Turnkey Project

Koolzuurhoudende Drank Vullijn van A tot Z Turnkey Project

US$ 5.000,00-200.000,00
1 Set(MOQ)
Drankenproductielijn Water Sap Productie Fabrikanten & Leveranciers

Drankenproductielijn Water Sap Productie Fabrikanten & Leveranciers

US$ 5.000,00-200.000,00
1 Set(MOQ)
Drankvullijnapparatuur van A tot Z Turnkey Project

Drankvullijnapparatuur van A tot Z Turnkey Project

US$ 5.000,00-200.000,00
1 Set(MOQ)
Volledig Automatische Koolzuurhoudende Drank Flesproductielijn

Volledig Automatische Koolzuurhoudende Drank Flesproductielijn

US$ 5.000,00-200.000,00
1 Set(MOQ)
1/4

Henan Welly Machinery Equipment Co., Ltd.

5.0
Verstuur aanvraag
Grote Capaciteit Kwartel Eieren Schilmachine Lijn Kwartel Eieren Verwerkingslijn Kwartel Eieren Kook- en Breeklijn

Grote Capaciteit Kwartel Eieren Schilmachine Lijn Kwartel Eieren Verwerkingslijn Kwartel Eieren Kook- en Breeklijn

US$ 8.530,00-9.560,00
1 Stuk(MOQ)
Hele Export Kipfilet Paneermeel Machine Hamburger Patty Maker Patty Maker Proceslijn

Hele Export Kipfilet Paneermeel Machine Hamburger Patty Maker Patty Maker Proceslijn

US$ 25.900,00-56.800,00
1 Stuk(MOQ)
Nieuwe Stijl Pulp Mengmachine Hamburger Patty Maker Kip Nuggets Productielijn

Nieuwe Stijl Pulp Mengmachine Hamburger Patty Maker Kip Nuggets Productielijn

US$ 25.900,00-56.800,00
1 Stuk(MOQ)
Automatische industriële beslagmaker, broodkruimelmachine, kipnugget verwerkingslijn

Automatische industriële beslagmaker, broodkruimelmachine, kipnugget verwerkingslijn

US$ 3.500,00-21.000,00
1 Stuk(MOQ)
1/4

Shandong Wanze Shengshi Environmental Protection Technology Co., Ltd

Verstuur aanvraag
Hoge efficiëntie PET-fles water vullijn voor drankfabriek

Hoge efficiëntie PET-fles water vullijn voor drankfabriek

US$ 5.000,00-200.000,00
1 Set(MOQ)
Kleine fabriek / Automatische watervullijn / Verpakkingsproductielijn / Drankvloeistof

Kleine fabriek / Automatische watervullijn / Verpakkingsproductielijn / Drankvloeistof

US$ 10.000,00-200.000,00
1 Set(MOQ)
Sanitaire mineraalwater vullijn voor drankverwerking

Sanitaire mineraalwater vullijn voor drankverwerking

US$ 5.000,00-200.000,00
1 Set(MOQ)
Dz003 250ml330ml Aluminium Blikjesmachine Koolzuurhoudende Drank Blik Vulmachine Productielijn

Dz003 250ml330ml Aluminium Blikjesmachine Koolzuurhoudende Drank Blik Vulmachine Productielijn

US$ 10.000,00-200.000,00
1 Set(MOQ)
1/4

HEBEI PINGLE GRAIN TECHNOLOGY INTELLIGENT EQUIPMENT CO., LTD.

31 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Maïsmeelmalingsproceslijnontwerp

Maïsmeelmalingsproceslijnontwerp

US$ 180.000,00-220.000,00
1 Set(MOQ)
**300t/H** Geoptimaliseerde tarwe meelmalingsproceslijn voor energiebesparing en hoge opbrengst

**300t/H** Geoptimaliseerde tarwe meelmalingsproceslijn voor energiebesparing en hoge opbrengst

US$ 200.000,00-3.500.000,00
1 Set(MOQ)
**980t/H** Geoptimaliseerde 950t Tarwe Meel Maalproceslijn met Geavanceerde Controle

**980t/H** Geoptimaliseerde 950t Tarwe Meel Maalproceslijn met Geavanceerde Controle

US$ 20.000,00-3.500.000,00
1 Set(MOQ)
Tarwe Meel Productielijn Ontwerp

Tarwe Meel Productielijn Ontwerp

US$ 350.000,00-3.500.000,00
1 Set(MOQ)
1/4

Henger Manufacturing (Shandong) Machinery Technology Co., Ltd.

8 jaar·5.0
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Vacuumverpakkingslijn voor vleesverwerkingsfabriek van vleesverwerkingsmachine

Vacuumverpakkingslijn voor vleesverwerkingsfabriek van vleesverwerkingsmachine

US$ 10.000,00-50.000,00
1 Stuk(MOQ)
Vleesverpakkingslijn voor vleesverwerkingsverpakkingsmachine

Vleesverpakkingslijn voor vleesverwerkingsverpakkingsmachine

US$ 10.000,00-50.000,00
1 Stuk(MOQ)
Verpakkingslijn en vleesverpakkingslijn voor vleesverwerkingsfabriek

Verpakkingslijn en vleesverpakkingslijn voor vleesverwerkingsfabriek

US$ 10.000,00-50.000,00
1 Stuk(MOQ)
Grootschalige volksslachting van hele Varken volledig automatisch slachten van varkens Apparatuur

Grootschalige volksslachting van hele Varken volledig automatisch slachten van varkens Apparatuur

US$ 9.000,00-18.000,00
1 Stuk(MOQ)
1/4

Ace-Filling (Suzhou) Packaging Machinery Co., Ltd.

6 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Duurzaam Compleet Lijn Drinkwater Vulapparatuur Efficiënt Bottelproductieproces

Duurzaam Compleet Lijn Drinkwater Vulapparatuur Efficiënt Bottelproductieproces

US$ 10.000,00-15.000,00
1 Set(MOQ)
2025 Snelle 500ml Plastic Fles Drinkwater Vulpuntlijn Gestroomlijnd Bottelproces

2025 Snelle 500ml Plastic Fles Drinkwater Vulpuntlijn Gestroomlijnd Bottelproces

US$ 10.000,00-15.000,00
1 Set(MOQ)
Plastic Flessen Water Productieproces Verpakking Vullen Machine Automatische Mineraalwater Productielijn

Plastic Flessen Water Productieproces Verpakking Vullen Machine Automatische Mineraalwater Productielijn

US$ 10.000,00-15.000,00
1 Set(MOQ)
Sterren Hoge Snelheid 500ml Pet Fles Water Vulpinstallatie Moderne Productieproces

Sterren Hoge Snelheid 500ml Pet Fles Water Vulpinstallatie Moderne Productieproces

US$ 10.000,00-15.000,00
1 Set(MOQ)
1/4

Suzhou Planet Machinery Co., Ltd.

5.0
Verstuur aanvraag
Turnkey Project van A tot Z Koolzuurhoudende Frisdrank Olie Detergent Shampoo Spoelen Vullen Afsluiten Labelen Verpakken Productieproceslijn

Turnkey Project van A tot Z Koolzuurhoudende Frisdrank Olie Detergent Shampoo Spoelen Vullen Afsluiten Labelen Verpakken Productieproceslijn

US$ 11.000,00-42.000,00
1 Set(MOQ)
Petfles Bottelen Heet Vullen Verpakkingsproces Productielijn Kokosnoot Still Sap Heet Vullen Productie Verwerking Vullijn

Petfles Bottelen Heet Vullen Verpakkingsproces Productielijn Kokosnoot Still Sap Heet Vullen Productie Verwerking Vullijn

US$ 9.000,00-28.000,00
1 Set(MOQ)
Automatische NFC vruchtensap energiedranken gearomatiseerd water niet-koolzuurhoudende drank waterglas PET-fles bottelen hete vulling verpakkingsproces productielijn

Automatische NFC vruchtensap energiedranken gearomatiseerd water niet-koolzuurhoudende drank waterglas PET-fles bottelen hete vulling verpakkingsproces productielijn

US$ 11.000,00-42.000,00
1 Set(MOQ)
18000bph 0.2L-2L Drinkwater Botteling Plant Proces Oplossing

18000bph 0.2L-2L Drinkwater Botteling Plant Proces Oplossing

US$ 17.500,00-88.000,00
1 Set(MOQ)
1/4

Zhangjiagang Huanyu Beverage Machinery Co., Ltd.

Verstuur aanvraag
Volledige sap bottelingsmachine sinaasappelsap productieproces/PET plastic sapflesvuller glazen fles sapvullijn vruchtvlees sap maakmachine

Volledige sap bottelingsmachine sinaasappelsap productieproces/PET plastic sapflesvuller glazen fles sapvullijn vruchtvlees sap maakmachine

US$ 20.000,00
1 Set(MOQ)
Fabrieksprijs fabrikant koolzuurhoudende frisdrank sodawater PET-fles cola maken vulmachine

Fabrieksprijs fabrikant koolzuurhoudende frisdrank sodawater PET-fles cola maken vulmachine

US$ 20.000,00
1 Stuk(MOQ)
Eenvoudig te bedienen automatische 500ml soda koolzuurhoudende drank sprankelend water vulproductielijn

Eenvoudig te bedienen automatische 500ml soda koolzuurhoudende drank sprankelend water vulproductielijn

US$ 20.000,00
1 Stuk(MOQ)
Volledige Fles Red Bull Energie Drank Sap Verwerking Vulproductielijn

Volledige Fles Red Bull Energie Drank Sap Verwerking Vulproductielijn

Bespreekbaar
1 Stuk(MOQ)
1/4

Shandong Light M & E Co., Ltd.

Verstuur aanvraag
Nieuwe Ontwerp Broodkruimel Proceslijn

Nieuwe Ontwerp Broodkruimel Proceslijn

US$ 8.000,00-30.000,00
1 Set(MOQ)
Grote Capaciteit Granulaire Broodkruimels Verwerkingslijn

Grote Capaciteit Granulaire Broodkruimels Verwerkingslijn

US$ 8.000,00-30.000,00
1 Set(MOQ)
Textured Soy Protein Voedselverwerkingslijn

Textured Soy Protein Voedselverwerkingslijn

Bespreekbaar
1 Set(MOQ)
Gefrituurde Snack Voedsel Verwerkingslijn

Gefrituurde Snack Voedsel Verwerkingslijn

US$ 42.000,00
1 Set(MOQ)
1/4

Henan Orange Industry Co., Ltd.

11 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Nieuwe Automatische Gepofte Kaasbal Rijst Maakmachine 3D Snack Voedsel Verwerkingslijn Maïs Puff Extruder

Nieuwe Automatische Gepofte Kaasbal Rijst Maakmachine 3D Snack Voedsel Verwerkingslijn Maïs Puff Extruder

US$ 17.980,00-18.800,00
1 Stuk(MOQ)
Voedselproduct huisdierensnoepjes maakmachine rijst maïs puff snack proceslijn voor kleine bedrijven Indiaas

Voedselproduct huisdierensnoepjes maakmachine rijst maïs puff snack proceslijn voor kleine bedrijven Indiaas

US$ 17.980,00-18.800,00
1 Stuk(MOQ)
Roestvrijstalen koeienmelk pasteurisatie tank procesinstallatie pasteurisatie machine mini melk verwerkingslijn

Roestvrijstalen koeienmelk pasteurisatie tank procesinstallatie pasteurisatie machine mini melk verwerkingslijn

US$ 2.150,00-32.000,00
1 Stuk(MOQ)
Verse Melk Pasteurisatie Homogenisator Tank Yoghurt Zuivel Proces Machine Yoghurt Lijn

Verse Melk Pasteurisatie Homogenisator Tank Yoghurt Zuivel Proces Machine Yoghurt Lijn

US$ 12.000,00-23.500,00
1 Stuk(MOQ)
1/4

Shanghai Genyond Technology Co., Ltd.

13 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Automatische Gepasteuriseerde Melk Verwerkingslijn Goedkope Prijs te Koop

Automatische Gepasteuriseerde Melk Verwerkingslijn Goedkope Prijs te Koop

US$ 13.800,00-88.000,00
1 Set(MOQ)
Hoge Efficiëntie Notenmelk Verwerkingslijn

Hoge Efficiëntie Notenmelk Verwerkingslijn

US$ 150.000,00
1 Set(MOQ)
Appelsap Persmachine Sapproductielijn

Appelsap Persmachine Sapproductielijn

US$ 80.000,00-150.000,00
1 Stuk(MOQ)
Datum Pasta Sap Sirop Wijn Datu Azijn Productielijn

Datum Pasta Sap Sirop Wijn Datu Azijn Productielijn

US$ 90.000,00
1 Stuk(MOQ)
1/4

Shanghai Chidan Technology & Engineering Co. Ltd

5.0
Verstuur aanvraag
Sesam Reinigingsproceslijn Sesam Pellen Werkplaats

Sesam Reinigingsproceslijn Sesam Pellen Werkplaats

US$ 10.000,00-500.000,00
1 Set(MOQ)
Droge sesamafschilmachine sesamaprocesslijn voor tahinaproductie

Droge sesamafschilmachine sesamaprocesslijn voor tahinaproductie

US$ 10.000,00-500.000,00
1 Set(MOQ)
Eetbare olie pers raffinage machines verwerkings geïntegreerde productielijn

Eetbare olie pers raffinage machines verwerkings geïntegreerde productielijn

US$ 100.000,00-200.000,00
1 Set(MOQ)
Aangepaste 5-200 Ton Per Dag Groenteolie Verwerkingsinstallatie Olie Raffinage Productielijn

Aangepaste 5-200 Ton Per Dag Groenteolie Verwerkingsinstallatie Olie Raffinage Productielijn

US$ 100.000,00-200.000,00
1 Set(MOQ)
1/4

Jiangsu Sinopak Tec Machinery Co, Ltd.

Verstuur aanvraag
500ml Pet Glazen Fles Koolzuurhoudende Drank Bottelen Vullen Lijn Productielijn Sprankelend Gas Soda Water Proces Systeem Vullen Labelen Productielijn

500ml Pet Glazen Fles Koolzuurhoudende Drank Bottelen Vullen Lijn Productielijn Sprankelend Gas Soda Water Proces Systeem Vullen Labelen Productielijn

US$ 20.000,00-22.000,00
1 Stuk(MOQ)
3000bph Sprankelend Water Botteling Plant Drank Sap Vulmachine Productielijn Frisdrank Vullijn Vloeistof Vulmachine Cola Koolzuurhoudend Water Proceslijn

3000bph Sprankelend Water Botteling Plant Drank Sap Vulmachine Productielijn Frisdrank Vullijn Vloeistof Vulmachine Cola Koolzuurhoudend Water Proceslijn

US$ 20.000,00-22.000,00
1 Stuk(MOQ)
Voltooi een A tot Z Automatisch Koolzuurhoudend Frisdrank Proces Systeem Koolzuurhoudend Water Vullijn Soda Sprankelend Water Bottellijn Productielijn

Voltooi een A tot Z Automatisch Koolzuurhoudend Frisdrank Proces Systeem Koolzuurhoudend Water Vullijn Soda Sprankelend Water Bottellijn Productielijn

US$ 25.000,00-26.000,00
1 Stuk(MOQ)
24000bph Mineraalwater Vul-/Bottellijn/Productielijn Turnkey Project

24000bph Mineraalwater Vul-/Bottellijn/Productielijn Turnkey Project

US$ 75.000,00
1 Set(MOQ)
1/4

Zhangjiagang Keyuan Machinery Co., Ltd.

16 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
16000cph 330ml Kleine Blik 2 in 1 Rotatie Type Aluminium Frisdrank Fruit Sap Vitamine Drank Proces Vulproductielijn

16000cph 330ml Kleine Blik 2 in 1 Rotatie Type Aluminium Frisdrank Fruit Sap Vitamine Drank Proces Vulproductielijn

US$ 35.000,00-40.000,00
1 set(MOQ)
Volledige Turnkey Aluminium Blikjes Vulmachine Lijn voor Koolzuurhoudende Frisdranken met Mengproces Systeem

Volledige Turnkey Aluminium Blikjes Vulmachine Lijn voor Koolzuurhoudende Frisdranken met Mengproces Systeem

US$ 10.000,00-20.000,00
1 set(MOQ)
Voltooi Project Huisdier/Glazen Fles CSD Frisdrank Koolzuurhoudende Gearomatiseerde Sap Proces Vullen Bottelen Wikkelen Machine Lijn

Voltooi Project Huisdier/Glazen Fles CSD Frisdrank Koolzuurhoudende Gearomatiseerde Sap Proces Vullen Bottelen Wikkelen Machine Lijn

US$ 10.000,00-15.000,00
1 set(MOQ)
Automatische Vodka Botteling Vulmachine Fruitwijn Vloeistof Verpakkingsvullijn

Automatische Vodka Botteling Vulmachine Fruitwijn Vloeistof Verpakkingsvullijn

US$ 25.000,00-30.000,00
1 set(MOQ)
1/4

Shanghai Stable Industrial Co., Ltd.

19 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Hoge Kwaliteit Drank UHT Proceslijn

Hoge Kwaliteit Drank UHT Proceslijn

US$ 80.000,00
1 Set(MOQ)
Semi-automatische pasteurizer voor volle melk verwerkingslijn

Semi-automatische pasteurizer voor volle melk verwerkingslijn

US$ 100.000,00-9.000.000,00
1 Set(MOQ)
Goede Kwaliteit Tomatenpuree/Saus/Ketchup Maakmachine Verwerkingslijn

Goede Kwaliteit Tomatenpuree/Saus/Ketchup Maakmachine Verwerkingslijn

US$ 20.000,00-1.000.000,00
1 Set(MOQ)
Roerbare Amandel Yoghurt Productielijn

Roerbare Amandel Yoghurt Productielijn

US$ 80.000,00-2.000.000,00
1 Set(MOQ)
1/4

Shanghai Marya Pharmaceutical Engineering & Project Co., Ltd.

12 jaar·5.0
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Marya Vaccine/Insulin Special Pre-Filled Needle Filling Line Supports The Whole Process of Aseptic Production of Syringes with or Without Needles

Marya Vaccine/Insulin Special Pre-Filled Needle Filling Line Supports The Whole Process of Aseptic Production of Syringes with or Without Needles

US$ 200.000,00
1 Stuk(MOQ)
Marya Automatische Oordruppels Vloeistof Vullen Afdekken Labelen Koppeling Lijn Onder ISO GMP Normen Van Chinese Originele Fabrikant

Marya Automatische Oordruppels Vloeistof Vullen Afdekken Labelen Koppeling Lijn Onder ISO GMP Normen Van Chinese Originele Fabrikant

US$ 50.000,00
1 Stuk(MOQ)
Marya Glazen Fles Fleswassen Steriliseren Vullen Stoppen Dichten Koppeling Lijn voor Vloeistof Poeder Verpakking OEM Oplossing

Marya Glazen Fles Fleswassen Steriliseren Vullen Stoppen Dichten Koppeling Lijn voor Vloeistof Poeder Verpakking OEM Oplossing

US$ 40.000,00
1 Stuk(MOQ)
Shanghai Marya Oogdruppel Oordruppel Vloeistof Vullen Labelen Koppeling Lijn met Pcl Controle GMP ISO 7 8 Chinese Fabriek

Shanghai Marya Oogdruppel Oordruppel Vloeistof Vullen Labelen Koppeling Lijn met Pcl Controle GMP ISO 7 8 Chinese Fabriek

US$ 20.000,00
1 Stuk(MOQ)
1/4

Jinan Dayi Extrusion Machinery Co., Ltd.

22 jaar
·Fabrikant/fabriek
Verstuur aanvraag
2D Pellet Snack Voedselproductieproces Plant/3D Pellet Snacks Productielijn

2D Pellet Snack Voedselproductieproces Plant/3D Pellet Snacks Productielijn

Bespreekbaar
1 Stuk(MOQ)
Volledig Automatische Geëxtrudeerde Gele Panko Broodkruimel Maaklijn

Volledig Automatische Geëxtrudeerde Gele Panko Broodkruimel Maaklijn

US$ 10.000,00
1 Stuk(MOQ)
300-400 Kg/H Industriële Panko Broodkruimels Productielijn

300-400 Kg/H Industriële Panko Broodkruimels Productielijn

US$ 10.000,00
1 Stuk(MOQ)
Geavanceerde Volledig Automatische RVS Broodkruimelmachine Lijn

Geavanceerde Volledig Automatische RVS Broodkruimelmachine Lijn

US$ 10.000,00
1 Stuk(MOQ)
1/4

Qingzhou Gofar Packaging Machinery Co., Ltd.

15 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Glazen Fles Groentesap Vullen Afsluitproces Lijn

Glazen Fles Groentesap Vullen Afsluitproces Lijn

US$ 10.000,00-500.000,00
1 Stuk(MOQ)
Automatische 330ml Mango Verse Fruit Sap Fles Vul Productielijn

Automatische 330ml Mango Verse Fruit Sap Fles Vul Productielijn

US$ 10.000,00-18.800,00
1 Stuk(MOQ)
Glazen Fles Sap en Drank Vullen - Doppen - Etiketteren Productielijn

Glazen Fles Sap en Drank Vullen - Doppen - Etiketteren Productielijn

US$ 10.000,00-500.000,00
1 Stuk(MOQ)
Volledige Automatische Koolzuurhoudende Drankjes Soda Productielijn

Volledige Automatische Koolzuurhoudende Drankjes Soda Productielijn

US$ 10.000,00-500.000,00
1 Stuk(MOQ)
1/4

Zhucheng Qiangda Machinery Factory

23 jaar
·Fabrikant/fabriek & Handelsbedrijf
Verstuur aanvraag
Pasteurisatieproductielijn, ingeblikte zeevruchten, groenteproductielijn, natte huisdiervoeding verwerkingslijn

Pasteurisatieproductielijn, ingeblikte zeevruchten, groenteproductielijn, natte huisdiervoeding verwerkingslijn

US$ 200.000,00
1 sets(MOQ)
Sterilisatie assemblagelijn voor de conservenindustrie van vlees en vleesproducten

Sterilisatie assemblagelijn voor de conservenindustrie van vlees en vleesproducten

US$ 4.000,00-10.000,00
1 Stuk(MOQ)
Melk Pasteurisatie Verwerkingslijn, Glazen Fles Sterilisator, Tunnel Spray Pasteurizer

Melk Pasteurisatie Verwerkingslijn, Glazen Fles Sterilisator, Tunnel Spray Pasteurizer

US$ 15.000,00-20.000,00
1 sets(MOQ)
Pasteurisatie Machine Lage Temperatuur Sterilisatie van Melk, Yoghurt en Fruitsap

Pasteurisatie Machine Lage Temperatuur Sterilisatie van Melk, Yoghurt en Fruitsap

US$ 4.000,00-10.000,00
1 Stuk(MOQ)
1/4

ZHUCHENG MBC INDUSTRIAL & TRADING CO., LTD.

Verstuur aanvraag
Fabrieksprijs conservenindustrie conservenindustrie komkommer conservenfabriek

Fabrieksprijs conservenindustrie conservenindustrie komkommer conservenfabriek

US$ 18.000,00-79.000,00
1 Set(MOQ)
Aardappelchips Bevroren Frietjes Verwerkings Frituurproductielijn Gemaakt Door Zhucheng MBC

Aardappelchips Bevroren Frietjes Verwerkings Frituurproductielijn Gemaakt Door Zhucheng MBC

US$ 19.000,00-88.000,00
1 Set(MOQ)
Fabriek / Whosale Prijs Automatische OEM / ODM / aangepast Productielijn voor maïs

Fabriek / Whosale Prijs Automatische OEM / ODM / aangepast Productielijn voor maïs

US$ 29.000,00-120.000,00
1 Set(MOQ)
Continuele Volledig Automatische Aardappelchips Verwerkingsmachines en Productielijn Gemaakt door MBC

Continuele Volledig Automatische Aardappelchips Verwerkingsmachines en Productielijn Gemaakt door MBC

US$ 29.000,00-88.000,00
1 Set(MOQ)
1/4

Henan Methena Intelligent Technology Co., Ltd

5.0
Verstuur aanvraag
Volautomatische Madeleinemaker Engelse cupcake proces cupcake muffin sponscake productielijn

Volautomatische Madeleinemaker Engelse cupcake proces cupcake muffin sponscake productielijn

US$ 8.500,00-35.000,00
1 Stuk(MOQ)
Volledig Automatische Complete Maïs Tarwe Maïsmeel Productielijn

Volledig Automatische Complete Maïs Tarwe Maïsmeel Productielijn

US$ 20.000,00
1 Stuk(MOQ)
Volledig automatisch kleine yoghurt Mini Cow Milk Pasteurisator-proces Apparatuur melk productie lijn prijs

Volledig automatisch kleine yoghurt Mini Cow Milk Pasteurisator-proces Apparatuur melk productie lijn prijs

US$ 10.000,00-14.800,00
1 Set(MOQ)
Stokvorm Puffende Maïs Snack Maakmachine Lijn Extrusie Kaasbal Puffende Productielijn

Stokvorm Puffende Maïs Snack Maakmachine Lijn Extrusie Kaasbal Puffende Productielijn

US$ 11.000,00-12.000,00
1 Stuk(MOQ)
1/4
1140
Over Ons Verklaring Gebruikersovereenkomst Privacybeleid Neem contact op met Made-in-China.com Topproducten Inzichten
Taal Opties: English 简体中文 繁體中文 日本語 Français Español Deutsch Português Italiano Русский язык 한국어 العربية Nederlands हिन्दी ภาษาไทย Türkçe Tiếng Việt Bahasa Indonesia
Copyright ©2026 Focus Technology Co., Ltd. Alle rechten voorbehouden
Focus is niet verantwoordelijk voor het inhoudelijke verschil van de website tussen de Engelse versie en andere taalversies. In geval van discrepantie tussen verschillende talenversies, zal de Engelse versie voorrang hebben . Door gebruik te maken van deze Website aanvaardt en erkent U zonder enig voorbehoud onze gebruiksvoorwaarden.